MRPL28 antibody (Middle Region)
-
- Target See all MRPL28 Antibodies
- MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRPL28 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MRPL28 antibody was raised against the middle region of MRPL28
- Purification
- Affinity purified
- Immunogen
- MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK
- Top Product
- Discover our top product MRPL28 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRPL28 Blocking Peptide, catalog no. 33R-2324, is also available for use as a blocking control in assays to test for specificity of this MRPL28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))
- Alternative Name
- MRPL28 (MRPL28 Products)
- Synonyms
- MAAT1 antibody, p15 antibody, CG3782 antibody, Dmel\\CG3782 antibody, MRP-L28 antibody, 1110015G04Rik antibody, L28mt antibody, GB14554 antibody, MRPL28 antibody, maat1 antibody, wu:fa96b11 antibody, zgc:110013 antibody, mitochondrial ribosomal protein L28 antibody, 39S ribosomal protein L28, mitochondrial antibody, mitochondrial ribosomal protein L28 L homeolog antibody, mitochondrial 54S ribosomal protein YmL28 antibody, mitochondrial ribosomal protein subunit L28 (predicted) antibody, Putative mitochondrial ribosomal protein L28 antibody, MRPL28 antibody, mRpL28 antibody, Mrpl28 antibody, LOC412473 antibody, mrpl28.L antibody, mrpl28 antibody, CAALFM_C108520CA antibody
- Background
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases
-