WARS2 antibody (Middle Region)
-
- Target See all WARS2 Antibodies
- WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WARS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WARS2 antibody was raised against the middle region of WARS2
- Purification
- Affinity purified
- Immunogen
- WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
- Top Product
- Discover our top product WARS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WARS2 Blocking Peptide, catalog no. 33R-9322, is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))
- Alternative Name
- WARS2 (WARS2 Products)
- Synonyms
- 5730427B17Rik antibody, 9430020O07Rik antibody, AI413375 antibody, TrpRS antibody, zgc:110828 antibody, tryptophanyl tRNA synthetase 2, mitochondrial antibody, tryptophanyl tRNA synthetase 2 (mitochondrial) antibody, WARS2 antibody, Wars2 antibody, wars2 antibody
- Background
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.
- Molecular Weight
- 24 kDa (MW of target protein)
-