MRPL39 antibody (N-Term)

Catalog No. ABIN630985

Product Details anti-MRPL39 Antibody

Target: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL39 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL39 antibody was raised against the N terminal of MRPL39

Purification: Affinity purified

Immunogen: MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL39 Blocking Peptide, catalog no. 33R-9047, is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL39

Target: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Alternative Name: MRPL39 (MRPL39 Products)

Synonyms: CG17166 antibody, Dmel\\CG17166 antibody, MRP-L5 antibody, mRpL5 antibody, C21orf92 antibody, L39mt antibody, MRPL5 antibody, PRED22 antibody, PRED66 antibody, RPML5 antibody, C21orf8 antibody, ORF22 antibody, Rpml5 antibody, mitochondrial ribosomal protein L39 antibody, mitochondrial ribosomal protein L39 L homeolog antibody, mRpL39 antibody, mrpl39.L antibody, MRPL39 antibody, Mrpl39 antibody

Background: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Molecular Weight: 39 kDa (MW of target protein)