MRPL15 antibody (C-Term)

Catalog No. ABIN630982

Product Details anti-MRPL15 Antibody

Target: MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL15 antibody was raised against the C terminal of MRPL15

Purification: Affinity purified

Immunogen: MRPL15 antibody was raised using the C terminal of MRPL15 corresponding to a region with amino acids KDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL15 Blocking Peptide, catalog no. 33R-4283, is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL15

Target: MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Alternative Name: MRPL15 (MRPL15 Products)

Synonyms: L15mt antibody, MRP-L15 antibody, MRP-L7 antibody, RPML7 antibody, HSPC145 antibody, Rpml7 antibody, zgc:92856 antibody, mitochondrial ribosomal protein L15 antibody, mitochondrial ribosomal protein L15 L homeolog antibody, MRPL15 antibody, Mrpl15 antibody, mrpl15 antibody, mrpl15.L antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.

Molecular Weight: 33 kDa (MW of target protein)