WBP11 antibody (N-Term)

Catalog No. ABIN630981

Product Details anti-WBP11 Antibody

Target: WBP11 (WW Domain Binding Protein 11 (WBP11))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WBP11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WBP11 antibody was raised against the N terminal of WBP11

Purification: Affinity purified

Immunogen: WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WBP11 Blocking Peptide, catalog no. 33R-3541, is also available for use as a blocking control in assays to test for specificity of this WBP11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WBP11

Target: WBP11 (WW Domain Binding Protein 11 (WBP11))

Alternative Name: WBP11 (WBP11 Products)

Synonyms: 2510026P17Rik antibody, D6Wsu113e antibody, Npwbp antibody, SIPP1 antibody, MGC69268 antibody, SNP70 antibody, zgc:77390 antibody, NPWBP antibody, WBP-11 antibody, WW domain binding protein 11 antibody, WW domain binding protein 11 S homeolog antibody, Wbp11 antibody, WBP11 antibody, wbp11.S antibody, wbp11 antibody, Tsp_13063 antibody

Background: WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Molecular Weight: 70 kDa (MW of target protein)