GCDH antibody (N-Term)

Catalog No. ABIN630975

Product Details anti-GCDH Antibody

Target: GCDH (Glutaryl-CoA Dehydrogenase (GCDH))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCDH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GCDH antibody was raised against the N terminal of GCDH

Purification: Affinity purified

Immunogen: GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCDH Blocking Peptide, catalog no. 33R-8632, is also available for use as a blocking control in assays to test for specificity of this GCDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCDH

Target: GCDH (Glutaryl-CoA Dehydrogenase (GCDH))

Alternative Name: GCDH (GCDH Products)

Synonyms: ACAD5 antibody, GCD antibody, zgc:56505 antibody, zgc:77704 antibody, 9030411L18 antibody, AI266902 antibody, D17825 antibody, glutaryl-CoA dehydrogenase antibody, glutaryl-CoA dehydrogenase a antibody, glutaryl-Coenzyme A dehydrogenase antibody, GCDH antibody, Gcdh antibody, gcdha antibody

Background: GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45 kDa subunits.

Molecular Weight: 43 kDa (MW of target protein)