GCDH antibody (N-Term)
-
- Target See all GCDH Antibodies
- GCDH (Glutaryl-CoA Dehydrogenase (GCDH))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GCDH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GCDH antibody was raised against the N terminal of GCDH
- Purification
- Affinity purified
- Immunogen
- GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA
- Top Product
- Discover our top product GCDH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GCDH Blocking Peptide, catalog no. 33R-8632, is also available for use as a blocking control in assays to test for specificity of this GCDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCDH (Glutaryl-CoA Dehydrogenase (GCDH))
- Alternative Name
- GCDH (GCDH Products)
- Background
- GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45 kDa subunits.
- Molecular Weight
- 43 kDa (MW of target protein)
-