DLGAP5 antibody (N-Term)

Catalog No. ABIN630974

Product Details anti-DLGAP5 Antibody

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLGAP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DLG7 antibody was raised against the N terminal Of Dlg7

Purification: Affinity purified

Immunogen: DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLG7 Blocking Peptide, catalog no. 33R-2820, is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLGAP5

Target: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Alternative Name: DLG7 (DLGAP5 Products)

Synonyms: DLG7 antibody, dlg7 antibody, sb:cb647 antibody, zgc:92146 antibody, wu:fc96g08 antibody, wu:fe11c02 antibody, HURP antibody, C77459 antibody, C86398 antibody, Dap-5 antibody, Dlg7 antibody, Hurp antibody, mKIAA0008 antibody, DLG associated protein 5 antibody, discs, large (Drosophila) homolog-associated protein 5 antibody, DLGAP5 antibody, dlgap5 antibody, Dlgap5 antibody

Background: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

Molecular Weight: 95 kDa (MW of target protein)

Pathways: M Phase