PRODH2 antibody
-
- Target See all PRODH2 Antibodies
- PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRODH2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR
- Top Product
- Discover our top product PRODH2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRODH2 Blocking Peptide, catalog no. 33R-4976, is also available for use as a blocking control in assays to test for specificity of this PRODH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRODH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))
- Alternative Name
- PRODH2 (PRODH2 Products)
- Background
- PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.
- Molecular Weight
- 59 kDa (MW of target protein)
-