PDE1C antibody (N-Term)

Catalog No. ABIN630963

Product Details anti-PDE1C Antibody

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE1C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDE1 C antibody was raised against the N terminal of PDE1

Purification: Affinity purified

Immunogen: PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE1C Blocking Peptide, catalog no. 33R-2051, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE1C

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Alternative Name: PDE1C (PDE1C Products)

Synonyms: CG14940 antibody, CG14942 antibody, CG14943 antibody, CG14944 antibody, CG31757 antibody, CG31758 antibody, CG42325 antibody, CG44007 antibody, Dmel\\CG44007 antibody, Dmel_CG14940 antibody, Dmel_CG14943 antibody, Dmel_CG14944 antibody, Dmel_CG31757 antibody, Dmel_CG31758 antibody, Dmel_CG42325 antibody, PDE1C antibody, PDE1c antibody, GB13690 antibody, Hcam3 antibody, Phosphodiesterase 1c antibody, phosphodiesterase 1C antibody, calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A antibody, calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C antibody, phosphodiesterase 1C, calmodulin-dependent b antibody, Pde1c antibody, PDE1C antibody, LOC724389 antibody, LOC100019026 antibody, pde1cb antibody

Background: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma