DPPA2 antibody (N-Term)

Catalog No. ABIN630962

Product Details anti-DPPA2 Antibody

Target: DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPPA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DPPA2 antibody was raised against the N terminal of DPPA2

Purification: Affinity purified

Immunogen: DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPPA2 Blocking Peptide, catalog no. 33R-6792, is also available for use as a blocking control in assays to test for specificity of this DPPA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPPA2

Target: DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))

Alternative Name: DPPA2 (DPPA2 Products)

Synonyms: 2410088E07Rik antibody, C80932 antibody, D19Mgi18 antibody, ECAT15-2 antibody, CT100 antibody, PESCRG1 antibody, developmental pluripotency associated 2 antibody, ABC-type oliopeptide/dipeptide transporter, periplasmic binding protein DppA antibody, Dppa2 antibody, DPPA2 antibody, dppA2 antibody

Background: DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Stem Cell Maintenance