SPAG8 antibody (Middle Region)
-
- Target See all SPAG8 Antibodies
- SPAG8 (Sperm Associated Antigen 8 (SPAG8))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPAG8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SPAG8 antibody was raised against the middle region of SPAG8
- Purification
- Affinity purified
- Immunogen
- SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT
- Top Product
- Discover our top product SPAG8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPAG8 Blocking Peptide, catalog no. 33R-6974, is also available for use as a blocking control in assays to test for specificity of this SPAG8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPAG8 (Sperm Associated Antigen 8 (SPAG8))
- Alternative Name
- SPAG8 (SPAG8 Products)
- Background
- The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognised by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.
- Molecular Weight
- 53 kDa (MW of target protein)
-