SPAG8 antibody (Middle Region)

Catalog No. ABIN630959

Product Details anti-SPAG8 Antibody

Target: SPAG8 (Sperm Associated Antigen 8 (SPAG8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPAG8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPAG8 antibody was raised against the middle region of SPAG8

Purification: Affinity purified

Immunogen: SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPAG8 Blocking Peptide, catalog no. 33R-6974, is also available for use as a blocking control in assays to test for specificity of this SPAG8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPAG8

Target: SPAG8 (Sperm Associated Antigen 8 (SPAG8))

Alternative Name: SPAG8 (SPAG8 Products)

Synonyms: BS-84 antibody, HSD-1 antibody, SMP1 antibody, SPAG3 antibody, hSMP-1 antibody, MH-SPAG8 antibody, sperm associated antigen 8 antibody, SPAG8 antibody, Spag8 antibody

Background: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognised by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.

Molecular Weight: 53 kDa (MW of target protein)