ACTRT2 antibody (C-Term)
-
- Target See all ACTRT2 Antibodies
- ACTRT2 (Actin-Related Protein T2 (ACTRT2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTRT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACTRT2 antibody was raised against the C terminal of ACTRT2
- Purification
- Affinity purified
- Immunogen
- ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT
- Top Product
- Discover our top product ACTRT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACTRT2 Blocking Peptide, catalog no. 33R-4842, is also available for use as a blocking control in assays to test for specificity of this ACTRT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTRT2 (Actin-Related Protein T2 (ACTRT2))
- Alternative Name
- ACTRT2 (ACTRT2 Products)
- Background
- ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.
- Molecular Weight
- 42 kDa (MW of target protein)
-