LASP1 antibody (C-Term)
-
- Target See all LASP1 Antibodies
- LASP1 (LIM and SH3 Protein 1 (LASP1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LASP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LASP1 antibody was raised against the C terminal of LASP1
- Purification
- Affinity purified
- Immunogen
- LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN
- Top Product
- Discover our top product LASP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LASP1 Blocking Peptide, catalog no. 33R-8949, is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LASP1 (LIM and SH3 Protein 1 (LASP1))
- Alternative Name
- LASP1 (LASP1 Products)
- Synonyms
- lasp1 antibody, MGC53336 antibody, LASP1 antibody, MGC89667 antibody, Lasp-1 antibody, MLN50 antibody, AA408629 antibody, Def-4 antibody, SH3P6 antibody, Tg(Col1a1-lacZ)1Ngma antibody, fb92f05 antibody, wu:fb92f05 antibody, zgc:77542 antibody, lasp-1 antibody, mln50 antibody, LIM and SH3 protein 1 antibody, LIM and SH3 protein 1 L homeolog antibody, lasp1 antibody, lasp1.L antibody, LASP1 antibody, Lasp1 antibody
- Background
- LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.
- Molecular Weight
- 30 kDa (MW of target protein)
-