MAP3K1 antibody (C-Term)
-
- Target See all MAP3K1 Antibodies
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAP3K1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAP3 K1 antibody was raised against the C terminal of MAP3 1
- Purification
- Affinity purified
- Immunogen
- MAP3 K1 antibody was raised using the C terminal of MAP3 1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
- Top Product
- Discover our top product MAP3K1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAP3K1 Blocking Peptide, catalog no. 33R-4960, is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
- Alternative Name
- MAP3K1 (MAP3K1 Products)
- Background
- MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.
- Molecular Weight
- 164 kDa (MW of target protein)
- Pathways
- MAPK Signaling, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades
-