Gasdermin B antibody (N-Term)

Catalog No. ABIN630929

Product Details anti-Gasdermin B Antibody

Target: Gasdermin B (GSDMB)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Gasdermin B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSDML antibody was raised against the N terminal of GSDML

Purification: Affinity purified

Immunogen: GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSDML Blocking Peptide, catalog no. 33R-3791, is also available for use as a blocking control in assays to test for specificity of this GSDML antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSDML antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Gasdermin B

Target: Gasdermin B (GSDMB)

Alternative Name: GSDML (GSDMB Products)

Synonyms: GSDML antibody, PRO2521 antibody, gasdermin B antibody, GSDMB antibody

Background: GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway. It may also play a role in achieving and maintaining the final differentiation state of epithelial cells.

Molecular Weight: 45 kDa (MW of target protein)