CAMLG antibody (N-Term)

Catalog No. ABIN630925

Product Details anti-CAMLG Antibody

Target: CAMLG (Calcium Modulating Ligand (CAMLG))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAMLG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CAMLG antibody was raised against the N terminal of CAMLG

Purification: Affinity purified

Immunogen: CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAMLG Blocking Peptide, catalog no. 33R-5170, is also available for use as a blocking control in assays to test for specificity of this CAMLG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAMLG

Target: CAMLG (Calcium Modulating Ligand (CAMLG))

Alternative Name: CAMLG (CAMLG Products)

Synonyms: MGC53900 antibody, CAML antibody, AI385748 antibody, Camlg antibody, Caml antibody, calcium modulating ligand L homeolog antibody, calcium modulating ligand antibody, camlg.L antibody, CAMLG antibody, camlg antibody, Caml antibody, Camlg antibody

Background: The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. CAMLG functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway