PSMB5 antibody
-
- Target See all PSMB5 Antibodies
- PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMB5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ
- Top Product
- Discover our top product PSMB5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMB5 Blocking Peptide, catalog no. 33R-4193, is also available for use as a blocking control in assays to test for specificity of this PSMB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))
- Alternative Name
- PSMB5 (PSMB5 Products)
- Synonyms
- LMPX antibody, MB1 antibody, X antibody, etID309919.2 antibody, fb59c07 antibody, si:zc14a17.13 antibody, wu:fb59c07 antibody, x antibody, zgc:86820 antibody, proteasome subunit beta 5 antibody, proteasome (prosome, macropain) subunit, beta type 5 antibody, proteasome subunit beta 5 L homeolog antibody, proteasome (prosome, macropain) subunit, beta type, 5 antibody, PSMB5 antibody, psmb5 antibody, Psmb5 antibody, psmb5.L antibody
- Background
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB5 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-