PSMD8 antibody
-
- Target See all PSMD8 Antibodies
- PSMD8 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMD8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
- Top Product
- Discover our top product PSMD8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PSMD8 Blocking Peptide, catalog no. 33R-2234, is also available for use as a blocking control in assays to test for specificity of this PSMD8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMD8 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8))
- Alternative Name
- PSMD8 (PSMD8 Products)
- Synonyms
- HIP6 antibody, HYPF antibody, Nin1p antibody, Rpn12 antibody, S14 antibody, p31 antibody, hip6 antibody, hypf antibody, nin1p antibody, rpn12 antibody, psmd8b antibody, 6720456J22Rik antibody, AA407360 antibody, AL033291 antibody, AL033322 antibody, AL033323 antibody, C76433 antibody, psmd8 antibody, psmd8a antibody, fa93g07 antibody, fb17c09 antibody, fb49a10 antibody, zgc:86762 antibody, wu:fa93g07 antibody, wu:fb17c09 antibody, wu:fb49a10 antibody, PSMD8 antibody, proteasome 26S subunit, non-ATPase 8 antibody, proteasome 26S subunit, non-ATPase 8 S homeolog antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 antibody, proteasome 26S subunit, non-ATPase 8 L homeolog antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 pseudogene antibody, PSMD8 antibody, psmd8.S antibody, Psmd8 antibody, psmd8.L antibody, psmd8 antibody, LOC468490 antibody
- Background
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Proton Transport, Synthesis of DNA, SARS-CoV-2 Protein Interactome, Ubiquitin Proteasome Pathway
-