PSME3 antibody (N-Term)

Catalog No. ABIN630917

Product Details anti-PSME3 Antibody

Target: PSME3

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSME3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PSME3 antibody was raised against the N terminal of PSME3

Purification: Affinity purified

Immunogen: PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSME3 Blocking Peptide, catalog no. 33R-7157, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSME3

Target: PSME3

Alternative Name: PSME3 (PSME3 Products)

Synonyms: AA410043 antibody, AU020960 antibody, Ki antibody, PA28gamma antibody, REGgamma antibody, pa28g antibody, Ab2-371 antibody, PA28-gamma antibody, PA28G antibody, REG-GAMMA antibody, psme3b antibody, proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) antibody, proteasome activator subunit 3 antibody, proteasome activator subunit 3 S homeolog antibody, Psme3 antibody, PSME3 antibody, psme3.S antibody

Background: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA