GSTO2 antibody (N-Term)

Catalog No. ABIN630910

Product Details anti-GSTO2 Antibody

Target: GSTO2 (Glutathione S-Transferase omega 2 (GSTO2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTO2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSTO2 antibody was raised against the N terminal of GSTO2

Purification: Affinity purified

Immunogen: GSTO2 antibody was raised using the N terminal of GSTO2 corresponding to a region with amino acids VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTO2 Blocking Peptide, catalog no. 33R-9654, is also available for use as a blocking control in assays to test for specificity of this GSTO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTO2

Target: GSTO2 (Glutathione S-Transferase omega 2 (GSTO2))

Alternative Name: GSTO2 (GSTO2 Products)

Synonyms: GSTO 2-2 antibody, bA127L20.1 antibody, 1700020F09Rik antibody, 4930425C18Rik antibody, glutathione S-transferase omega 2 antibody, GSTO2 antibody, Gsto2 antibody

Background: The omega class glutathione transferases (GST, EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1).

Molecular Weight: 28 kDa (MW of target protein)