Transglutaminase 7 antibody (C-Term)

Catalog No. ABIN630909

Product Details anti-Transglutaminase 7 Antibody

Target: Transglutaminase 7 (TGM7)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Transglutaminase 7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Transglutaminase 7 antibody was raised against the C terminal of TGM7

Purification: Affinity purified

Immunogen: Transglutaminase 7 antibody was raised using the C terminal of TGM7 corresponding to a region with amino acids TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Transglutaminase 7 Blocking Peptide, catalog no. 33R-9245, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Transglutaminase 7

Target: Transglutaminase 7 (TGM7)

Alternative Name: Transglutaminase 7 (TGM7 Products)

Synonyms: TGMZ antibody, TGM7 antibody, TGz antibody, transglutaminase 7 antibody, TGM7 antibody, Tgm7 antibody

Background: Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilonlysine crosslinks. Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks.

Molecular Weight: 80 kDa (MW of target protein)