SULT1B1 antibody (N-Term)

Catalog No. ABIN630908

Product Details anti-SULT1B1 Antibody

Target: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SULT1 B1 antibody was raised against the N terminal of SULT1 1

Purification: Affinity purified

Immunogen: SULT1 B1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT1B1 Blocking Peptide, catalog no. 33R-4623, is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT1B1

Target: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Alternative Name: SULT1B1 (SULT1B1 Products)

Synonyms: ST1B1 antibody, ST1B2 antibody, SULT1B2 antibody, St2b2 antibody, SULT1B antibody, cSULT1B1 antibody, MGC80677 antibody, SULT1B1 antibody, sulfotransferase family 1B member 1 antibody, sulfotransferase family 1B, member 1 antibody, sulfotransferase family cytosolic 1B member 1 antibody, sulfotransferase family 1B member 1 S homeolog antibody, sulfotransferase family, cytosolic, 1B, member 1 antibody, SULT1B1 antibody, Sult1b1 antibody, sult1b1.S antibody, sult1b1 antibody, LOC100624541 antibody

Background: SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.

Molecular Weight: 35 kDa (MW of target protein)