PGK2 antibody (C-Term)

Catalog No. ABIN630896

Product Details anti-PGK2 Antibody

Target: PGK2 (Phosphoglycerate Kinase 2 (PGK2))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGK2 antibody was raised against the C terminal of PGK2

Purification: Affinity purified

Immunogen: PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGK2 Blocking Peptide, catalog no. 33R-4189, is also available for use as a blocking control in assays to test for specificity of this PGK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGK2

Target: PGK2 (Phosphoglycerate Kinase 2 (PGK2))

Alternative Name: PGK2 (PGK2 Products)

Synonyms: PGKB antibody, PGKPS antibody, dJ417L20.2 antibody, Pgk-2 antibody, Tcp-2 antibody, PGK2 antibody, phosphoglycerate kinase 2 antibody, PGK2 antibody, Pgk2 antibody, cbbK antibody

Background: PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP.

Molecular Weight: 46 kDa (MW of target protein)