Aquaporin 7 antibody (C-Term)

Catalog No. ABIN630892

Product Details anti-Aquaporin 7 Antibody

Target: Aquaporin 7 (AQP7)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aquaporin 7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Aquaporin 7 antibody was raised against the C terminal of AQP7

Purification: Affinity purified

Immunogen: Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA

Application Details

Application Notes: WB: 0.4 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Aquaporin 7 Blocking Peptide, catalog no. 33R-2182, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aquaporin 7

Target: Aquaporin 7 (AQP7)

Alternative Name: Aquaporin 7 (AQP7 Products)

Synonyms: fj98f09 antibody, wu:fj98f09 antibody, zgc:63700 antibody, aqp7l antibody, aqp9 antibody, aqpap antibody, AQP7 antibody, AQP7L antibody, AQP9 antibody, AQPap antibody, GLYCQTL antibody, SAQP7 antibody, aquaporin 7 antibody, aqp7 antibody, AQP7 antibody, Aqp7 antibody

Background: Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.

Molecular Weight: 37 kDa (MW of target protein)