EEF2 antibody (N-Term)
-
- Target See all EEF2 Antibodies
- EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Drosophila melanogaster, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EEF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EEF2 antibody was raised against the N terminal of EEF2
- Purification
- Affinity purified
- Immunogen
- EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND
- Top Product
- Discover our top product EEF2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EEF2 Blocking Peptide, catalog no. 33R-9020, is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))
- Alternative Name
- EEF2 (EEF2 Products)
- Background
- EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
- Molecular Weight
- 94 kDa (MW of target protein)
- Pathways
- AMPK Signaling
-