EEF2 antibody (N-Term)

Catalog No. ABIN630891

Product Details anti-EEF2 Antibody

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EEF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EEF2 antibody was raised against the N terminal of EEF2

Purification: Affinity purified

Immunogen: EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EEF2 Blocking Peptide, catalog no. 33R-9020, is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Alternative Name: EEF2 (EEF2 Products)

Synonyms: EEF-2 antibody, EF-2 antibody, EF2 antibody, Ef-2 antibody, eef2 antibody, MGC76191 antibody, MGC79628 antibody, EEF2 antibody, eef2l antibody, fe49h02 antibody, wu:fe49h02 antibody, zgc:63584 antibody, ef2 antibody, zef2 antibody, CG2238 antibody, Dmel\CG2238 antibody, EF-2b antibody, EF2B antibody, EF2b antibody, Ef2 antibody, Ef2B antibody, Ef2b antibody, anon-EST:Liang-1.44 antibody, chr2L:21668915..21669164 antibody, clone 1.44 antibody, eEF2 antibody, eF2 antibody, ef2b antibody, eukaryotic translation elongation factor 2 antibody, eukaryotic translation elongation factor 2, gene 1 antibody, eukaryotic translation elongation factor 2b antibody, Elongation factor 2 antibody, EEF2 antibody, Eef2 antibody, eef2.1 antibody, POSPLDRAFT_118836 antibody, eef2b antibody, eef-2 antibody, eef2 antibody, EF2 antibody

Background: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Molecular Weight: 94 kDa (MW of target protein)

Pathways: AMPK Signaling