ACADVL antibody (N-Term)

Catalog No. ABIN630886

Product Details anti-ACADVL Antibody

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADVL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACADVL antibody was raised against the N terminal of ACADVL

Purification: Affinity purified

Immunogen: ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACADVL Blocking Peptide, catalog no. 33R-8111, is also available for use as a blocking control in assays to test for specificity of this ACADVL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADVL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Alternative Name: ACADVL (ACADVL Products)

Synonyms: ACAD6 antibody, LCACD antibody, VLCAD antibody, vlcad antibody, fb52d04 antibody, wu:fb52d04 antibody, wu:fc75e01 antibody, zgc:64067 antibody, acyl-CoA dehydrogenase very long chain antibody, acyl-Coenzyme A dehydrogenase, very long chain antibody, acyl-CoA dehydrogenase, very long chain antibody, ACADVL antibody, Acadvl antibody, acadvl antibody

Background: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process