GLE1 antibody

Catalog No. ABIN630876

Product Details anti-GLE1 Antibody

Target: GLE1 (GLE1 RNA Export Mediator (GLE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLE1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLE1 Blocking Peptide, catalog no. 33R-5089, is also available for use as a blocking control in assays to test for specificity of this GLE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLE1

Target: GLE1 (GLE1 RNA Export Mediator (GLE1))

Alternative Name: GLE1 (GLE1 Products)

Synonyms: Dmel\\CG14749 antibody, GLE1 antibody, GLE1L antibody, LCCS antibody, LCCS1 antibody, hGLE1 antibody, Gle1l antibody, 4933405K21Rik antibody, AA553313 antibody, CG14749 gene product from transcript CG14749-RA antibody, nucleoporin GLE1 antibody, RNA export factor Gle1 antibody, GLE1, RNA export mediator antibody, GLE1 RNA export mediator antibody, GLE1 RNA export mediator (yeast) antibody, CG14749 antibody, CpipJ_CPIJ014147 antibody, SJAG_03847 antibody, GLE1 antibody, Gle1 antibody

Background: GLE1 is a predicted 75 kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes.

Molecular Weight: 75 kDa (MW of target protein)