PECI/ECI2 antibody (Middle Region)

Catalog No. ABIN630872

Product Details anti-PECI/ECI2 Antibody

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PECI/ECI2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PECI antibody was raised against the middle region of PECI

Purification: Affinity purified

Immunogen: PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PECI Blocking Peptide, catalog no. 33R-1595, is also available for use as a blocking control in assays to test for specificity of this PECI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PECI/ECI2

Target: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Alternative Name: PECI (PECI Products)

Synonyms: PECI antibody, ACBD2 antibody, DRS-1 antibody, DRS1 antibody, HCA88 antibody, dJ1013A10.3 antibody, Peci antibody, Acbd2 antibody, Drs1 antibody, Hca88 antibody, ECI2 antibody, wu:fd61c12 antibody, enoyl-CoA delta isomerase 2 antibody, enoyl-Coenzyme A delta isomerase 2 antibody, peroxisomal D3,D2-enoyl-CoA isomerase antibody, ECI2 antibody, Eci2 antibody, peci antibody, eci2 antibody

Background: PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.

Molecular Weight: 40 kDa (MW of target protein)