PECI/ECI2 antibody (Middle Region)
-
- Target See all PECI/ECI2 (PECI) Antibodies
- PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PECI/ECI2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PECI antibody was raised against the middle region of PECI
- Purification
- Affinity purified
- Immunogen
- PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK
- Top Product
- Discover our top product PECI Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PECI Blocking Peptide, catalog no. 33R-1595, is also available for use as a blocking control in assays to test for specificity of this PECI antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))
- Alternative Name
- PECI (PECI Products)
- Background
- PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.
- Molecular Weight
- 40 kDa (MW of target protein)
-