PHACTR3 antibody (C-Term)

Catalog No. ABIN630871

Product Details anti-PHACTR3 Antibody

Target: PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHACTR3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PHACTR3 antibody was raised against the C terminal of PHACTR3

Purification: Affinity purified

Immunogen: PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHACTR3 Blocking Peptide, catalog no. 33R-3947, is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHACTR3

Target: PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))

Alternative Name: PHACTR3 (PHACTR3 Products)

Synonyms: C20orf101 antibody, H17739 antibody, SCAPIN1 antibody, SCAPININ antibody, 1500003N10Rik antibody, 4930415A02Rik antibody, Scapin1 antibody, Scapinin antibody, mKIAA4224 antibody, scapinin antibody, h17739 antibody, scapin1 antibody, DKFZp459A1919 antibody, zgc:109967 antibody, zgc:172129 antibody, phosphatase and actin regulator 3 antibody, phosphatase and actin regulator 3 L homeolog antibody, phosphatase and actin regulator 3b antibody, phosphatase and actin regulator 3a antibody, PHACTR3 antibody, Phactr3 antibody, phactr3.L antibody, phactr3 antibody, LOC100543179 antibody, phactr3b antibody, phactr3a antibody

Background: PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.

Molecular Weight: 51 kDa (MW of target protein)