PHACTR3 antibody (C-Term)
-
- Target See all PHACTR3 Antibodies
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHACTR3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PHACTR3 antibody was raised against the C terminal of PHACTR3
- Purification
- Affinity purified
- Immunogen
- PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
- Top Product
- Discover our top product PHACTR3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHACTR3 Blocking Peptide, catalog no. 33R-3947, is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
- Alternative Name
- PHACTR3 (PHACTR3 Products)
- Background
- PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.
- Molecular Weight
- 51 kDa (MW of target protein)
-