POLR3B antibody (C-Term)

Catalog No. ABIN630870

Product Details anti-POLR3B Antibody

Target: POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR3B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POLR3 B antibody was raised against the C terminal of POLR3

Purification: Affinity purified

Immunogen: POLR3 B antibody was raised using the C terminal of POLR3 corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR3B Blocking Peptide, catalog no. 33R-3943, is also available for use as a blocking control in assays to test for specificity of this POLR3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR3B

Target: POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))

Alternative Name: POLR3B (POLR3B Products)

Synonyms: RGD1565311 antibody, C128 antibody, HLD8 antibody, RPC2 antibody, 2700078H01Rik antibody, A330032P03Rik antibody, C85372 antibody, RNA polymerase III subunit B antibody, polymerase (RNA) III (DNA directed) polypeptide B antibody, Polr3b antibody, POLR3B antibody

Background: POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.

Molecular Weight: 128 kDa (MW of target protein)