PPAT antibody (C-Term)
-
- Target See all PPAT Antibodies
- PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPAT antibody was raised against the C terminal of PPAT
- Purification
- Affinity purified
- Immunogen
- PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
- Top Product
- Discover our top product PPAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPAT Blocking Peptide, catalog no. 33R-7523, is also available for use as a blocking control in assays to test for specificity of this PPAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))
- Alternative Name
- PPAT (PPAT Products)
- Synonyms
- ATASE antibody, GPAT antibody, PRAT antibody, Atase antibody, 5730454C12Rik antibody, AA408689 antibody, AA675351 antibody, AI507113 antibody, C79945 antibody, im:6894693 antibody, si:dkeyp-117h8.5 antibody, wu:fb61f03 antibody, wu:fc28b09 antibody, phosphoribosyl pyrophosphate amidotransferase antibody, phosphoribosyl pyrophosphate amidotransferase L homeolog antibody, PPAT antibody, Ppat antibody, ppat.L antibody, ppat antibody
- Background
- PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.
- Molecular Weight
- 56 kDa (MW of target protein)
-