FKBP3 antibody (C-Term)
-
- Target See all FKBP3 Antibodies
- FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FKBP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FKBP3 antibody was raised against the C terminal of FKBP3
- Purification
- Affinity purified
- Immunogen
- FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
- Top Product
- Discover our top product FKBP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FKBP3 Blocking Peptide, catalog no. 33R-2266, is also available for use as a blocking control in assays to test for specificity of this FKBP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))
- Alternative Name
- FKBP3 (FKBP3 Products)
- Background
- FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
- Molecular Weight
- 25 kDa (MW of target protein)
-