GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) antibody

Catalog No. ABIN630853

Product Details

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169

Purification: Affinity purified

Immunogen: DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DKFZP761C169 Blocking Peptide, catalog no. 33R-7991, is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Abstract: GPBP1 Products

Synonyms: MGC80437 antibody, Vasculin antibody, DKFZp459A203 antibody, GPBP antibody, SSH6 antibody, VASCULIN antibody, 1700034P14Rik antibody, AU019836 antibody, D230035M11Rik antibody, Gpbp antibody, mGPBP antibody, RGD1305492 antibody, GC-rich promoter binding protein 1 L homeolog antibody, GC-rich promoter binding protein 1 antibody, gpbp1.L antibody, gpbp1 antibody, GPBP1 antibody, Gpbp1 antibody

Background: Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Molecular Weight: 52 kDa (MW of target protein)