SPNS2 antibody
-
- Target See all SPNS2 Antibodies
- SPNS2 (Spinster Homolog 2 (SPNS2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPNS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
- Top Product
- Discover our top product SPNS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPNS2 Blocking Peptide, catalog no. 33R-7255, is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPNS2 (Spinster Homolog 2 (SPNS2))
- Alternative Name
- SPNS2 (SPNS2 Products)
- Synonyms
- fi20h04 antibody, si:dkey-7b17.4 antibody, toh antibody, wu:fi20h04 antibody, DKFZp459J1933 antibody, spinster homolog 2 (Drosophila) antibody, sphingolipid transporter 2 antibody, spinster homolog 2 antibody, SPNS2 antibody, spns2 antibody, Spns2 antibody
- Background
- SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.
- Molecular Weight
- 60 kDa (MW of target protein)
-