UBR7 antibody (N-Term)
-
- Target See all UBR7 Antibodies
- UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBR7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C14 ORF130 antibody was raised against the N terminal Of C14 rf130
- Purification
- Affinity purified
- Immunogen
- C14 ORF130 antibody was raised using the N terminal Of C14 rf130 corresponding to a region with amino acids MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ
- Top Product
- Discover our top product UBR7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C14ORF130 Blocking Peptide, catalog no. 33R-5657, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))
- Alternative Name
- C14ORF130 (UBR7 Products)
- Background
- C14ORF130 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. C14ORF130 recognises and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
- Molecular Weight
- 48 kDa (MW of target protein)
-