UBR7 antibody (N-Term)

Catalog No. ABIN630845

Product Details anti-UBR7 Antibody

Target: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBR7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF130 antibody was raised against the N terminal Of C14 rf130

Purification: Affinity purified

Immunogen: C14 ORF130 antibody was raised using the N terminal Of C14 rf130 corresponding to a region with amino acids MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF130 Blocking Peptide, catalog no. 33R-5657, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBR7

Target: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Alternative Name: C14ORF130 (UBR7 Products)

Synonyms: C14orf130 antibody, 5730410I19Rik antibody, AA589405 antibody, AW557761 antibody, RGD1359144 antibody, ubiquitin protein ligase E3 component n-recognin 7 (putative) antibody, UBR7 antibody, Ubr7 antibody

Background: C14ORF130 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. C14ORF130 recognises and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Molecular Weight: 48 kDa (MW of target protein)