FLII antibody
-
- Target See all FLII Antibodies
- FLII (Flightless I Homolog (FLII))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FLII antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
- Top Product
- Discover our top product FLII Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLII Blocking Peptide, catalog no. 33R-4761, is also available for use as a blocking control in assays to test for specificity of this FLII antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLII antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLII (Flightless I Homolog (FLII))
- Alternative Name
- FLII (FLII Products)
- Background
- FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
- Molecular Weight
- 145 kDa (MW of target protein)
-