FLII antibody

Catalog No. ABIN630840

Product Details anti-FLII Antibody

Target: FLII (Flightless I Homolog (FLII))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FLII antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLII Blocking Peptide, catalog no. 33R-4761, is also available for use as a blocking control in assays to test for specificity of this FLII antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLII antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FLII

Target: FLII (Flightless I Homolog (FLII))

Alternative Name: FLII (FLII Products)

Synonyms: FLI antibody, FLIL antibody, Fli1 antibody, 3632430F08Rik antibody, Fliih antibody, im:7141769 antibody, DKFZp459O043 antibody, flightless antibody, FLII, actin remodeling protein antibody, flightless I actin binding protein antibody, protein flightless-1 homolog antibody, FLII, actin remodeling protein S homeolog antibody, Protein flightless-1 homolog antibody, FLII antibody, Flii antibody, flii antibody, LOC585336 antibody, LOC100640615 antibody, flii.S antibody, fli-1 antibody

Background: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Molecular Weight: 145 kDa (MW of target protein)