MPDZ antibody (Middle Region)

Catalog No. ABIN630839

Product Details anti-MPDZ Antibody

Target: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPDZ antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPDZ antibody was raised against the middle region of MPDZ

Purification: Affinity purified

Immunogen: MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPDZ Blocking Peptide, catalog no. 33R-1891, is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPDZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPDZ

Target: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Alternative Name: MPDZ (MPDZ Products)

Background: MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.

Molecular Weight: 218 kDa (MW of target protein)

Pathways: Synaptic Membrane, Phototransduction