MPDZ antibody (Middle Region)
-
- Target See all MPDZ Antibodies
- MPDZ (Multiple PDZ Domain Protein (MPDZ))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPDZ antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MPDZ antibody was raised against the middle region of MPDZ
- Purification
- Affinity purified
- Immunogen
- MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
- Top Product
- Discover our top product MPDZ Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MPDZ Blocking Peptide, catalog no. 33R-1891, is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPDZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPDZ (Multiple PDZ Domain Protein (MPDZ))
- Alternative Name
- MPDZ (MPDZ Products)
- Synonyms
- HYC2 antibody, MUPP1 antibody, AI225843 antibody, B930003D11Rik antibody, multiple PDZ domain crumbs cell polarity complex component antibody, multiple PDZ domain protein antibody, Multiple PDZ domain protein antibody, inactivation-no-after-potential D protein antibody, multiple pdz domain protein, putative antibody, MPDZ antibody, Mpdz antibody, mpz-1 antibody, LOC5569990 antibody, Smp_168960 antibody
- Background
- MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.
- Molecular Weight
- 218 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Phototransduction
-