Cytokeratin 13 antibody (N-Term)
-
- Target See all Cytokeratin 13 (KRT13) Antibodies
- Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cytokeratin 13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cytokeratin 13 antibody was raised against the N terminal of KRT13
- Purification
- Affinity purified
- Immunogen
- Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY
- Top Product
- Discover our top product KRT13 Primary Antibody
-
anti-Keratin 13 (KRT13) (N-Term) antibody
KRT13 Reactivity: Rat, Mouse IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Keratin 13 (KRT13) (AA 104-403) antibodyKRT13 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Keratin 13 (KRT13) (AA 104-458) antibodyKRT13 Reactivity: Human WB, IHC, ELISA, FACS Host: Mouse Monoclonal 7D7B3 unconjugated
anti-Keratin 13 (KRT13) (C-Term) antibodyKRT13 Reactivity: Rat, Mouse IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Keratin 13 (KRT13) antibodyKRT13 Reactivity: Human WB, IHC (p), IF, ICC, IHC (wm) Host: Rabbit Polyclonal unconjugated
anti-Keratin 13 (KRT13) (AA 143-295) antibodyKRT13 Reactivity: Human WB, ELISA, FACS Host: Mouse Monoclonal 3G4 unconjugated
anti-Keratin 13 (KRT13) (AA 269-458) antibodyKRT13 Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Keratin 13 (KRT13) antibodyKRT13 Reactivity: Human, Rat, Mouse WB, IHC (p), IF (cc) Host: Rabbit Monoclonal 5A3 unconjugated
anti-Keratin 13 (KRT13) antibodyKRT13 Reactivity: Human IHC, IF, StM Host: Mouse Monoclonal KRT13-2213 unconjugated
anti-Keratin 13 (KRT13) (AA 106-138), (N-Term) antibodyKRT13 Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB18903 unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cytokeratin 13 Blocking Peptide, catalog no. 33R-9208, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))
- Alternative Name
- Cytokeratin 13 (KRT13 Products)
- Synonyms
- krt13 antibody, CK13 antibody, K13 antibody, Ka13 antibody, Krt-1.13 antibody, Krt1-13 antibody, ck13 antibody, k13 antibody, keratin 24 antibody, keratin 13 antibody, keratin 13, type I S homeolog antibody, krt24 antibody, KRT13 antibody, Krt13 antibody, krt13.S antibody, k13 antibody
- Background
- KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
- Molecular Weight
- 46 kDa (MW of target protein)
-
