Copine IV antibody (C-Term)
-
- Target See all Copine IV (CPNE4) Antibodies
- Copine IV (CPNE4)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Copine IV antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Copine IV antibody was raised against the C terminal of CPNE4
- Purification
- Affinity purified
- Immunogen
- Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG
- Top Product
- Discover our top product CPNE4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Copine IV Blocking Peptide, catalog no. 33R-2291, is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Copine IV (CPNE4)
- Alternative Name
- Copine IV (CPNE4 Products)
- Synonyms
- CPNE4 antibody, COPN4 antibody, CPN4 antibody, 3632411M23Rik antibody, 4933406O10Rik antibody, si:dkey-5n4.1 antibody, copine 4 antibody, copine IV antibody, copine IVb antibody, CPNE4 antibody, cpne4 antibody, Cpne4 antibody, cpne4b antibody
- Background
- Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.
- Molecular Weight
- 62 kDa (MW of target protein)
-