ATE1 antibody (N-Term)

Catalog No. ABIN630829

Product Details anti-ATE1 Antibody

Target: ATE1 (Arginyltransferase 1 (ATE1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATE1 antibody was raised against the N terminal of ATE1

Purification: Affinity purified

Immunogen: ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATE1 Blocking Peptide, catalog no. 33R-1654, is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATE1

Target: ATE1 (Arginyltransferase 1 (ATE1))

Alternative Name: ATE1 (ATE1 Products)

Synonyms: ATE1 antibody, Ate antibody, CG9204 antibody, Dm-Ate1 antibody, Dmel\\CG9204 antibody, ate1 antibody, l(2)k10809 antibody, zgc:158849 antibody, AI225793 antibody, AW547406 antibody, CG9204 gene product from transcript CG9204-RA antibody, arginyltransferase 1 antibody, arginyltransferase 1 L homeolog antibody, Ate1 antibody, ATE1 antibody, ate1 antibody, ate1.L antibody

Background: ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome