LIAS antibody (C-Term)
-
- Target See all LIAS Antibodies
- LIAS (Lipoic Acid Synthetase (LIAS))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIAS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LIAS antibody was raised against the C terminal of LIAS
- Purification
- Affinity purified
- Immunogen
- LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK
- Top Product
- Discover our top product LIAS Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIAS Blocking Peptide, catalog no. 33R-2822, is also available for use as a blocking control in assays to test for specificity of this LIAS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIAS (Lipoic Acid Synthetase (LIAS))
- Alternative Name
- LIAS (LIAS Products)
- Synonyms
- LAS antibody, LIP1 antibody, LS antibody, PDHLD antibody, 2900022L22Rik antibody, 4933425M12Rik antibody, 7a5ex antibody, C77512 antibody, mLip1 antibody, zgc:66080 antibody, Lip-syn antibody, lipoyl synthase, mitochondrial antibody, lipoic acid synthetase antibody, lipoyl synthase antibody, lipoic acid synthetase S homeolog antibody, Lipoyl synthase, mitochondrial antibody, LOC5571879 antibody, THAPSDRAFT_31845 antibody, THAPSDRAFT_31673 antibody, UREG_00501 antibody, LOAG_04019 antibody, TERG_02451 antibody, Tsp_01534 antibody, LIAS antibody, Lias antibody, lias antibody, lias.S antibody, umc2251 antibody
- Background
- LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Tube Formation
-