AKR1B1 antibody

Catalog No. ABIN630825

Product Details anti-AKR1B1 Antibody

Target: AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKR1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AKR1 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKR1B1 Blocking Peptide, catalog no. 33R-1528, is also available for use as a blocking control in assays to test for specificity of this AKR1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKR1B1

Target: AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))

Alternative Name: AKR1B1 (AKR1B1 Products)

Synonyms: ADR antibody, ALDR1 antibody, ALR2 antibody, AR antibody, ALDRED antibody, ALR-P-I antibody, Akr1b3 antibody, Akr1b4 antibody, Aldr1 antibody, Alr antibody, RATALDRED antibody, akr1b7 antibody, zgc:86611 antibody, aldo-keto reductase family 1 member B antibody, aldo-keto reductase family 1, member B1 (aldose reductase) antibody, aldo-keto reductase family 1, member B1 (aldose reductase) S homeolog antibody, AKR1B1 antibody, Akr1b1 antibody, akr1b1.S antibody, akr1b1 antibody

Background: AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process