RNF44 antibody (N-Term)
-
- Target See all RNF44 Antibodies
- RNF44 (Ring Finger Protein 44 (RNF44))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF44 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF44 antibody was raised against the N terminal of RNF44
- Purification
- Affinity purified
- Immunogen
- RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL
- Top Product
- Discover our top product RNF44 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF44 Blocking Peptide, catalog no. 33R-5467, is also available for use as a blocking control in assays to test for specificity of this RNF44 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF44 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF44 (Ring Finger Protein 44 (RNF44))
- Alternative Name
- RNF44 (RNF44 Products)
- Synonyms
- AI854545 antibody, mKIAA1100 antibody, ring finger protein 44 antibody, RNF44 antibody, Rnf44 antibody
- Background
- The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
- Molecular Weight
- 48 kDa (MW of target protein)
-