FBXO24 antibody (N-Term)
-
- Target See all FBXO24 Antibodies
- FBXO24 (F-Box Protein 24 (FBXO24))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO24 antibody was raised against the N terminal of FBXO24
- Purification
- Affinity purified
- Immunogen
- FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG
- Top Product
- Discover our top product FBXO24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO24 Blocking Peptide, catalog no. 33R-9447, is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO24 (F-Box Protein 24 (FBXO24))
- Alternative Name
- FBXO24 (FBXO24 Products)
- Synonyms
- FBX24 antibody, 4933422D21Rik antibody, Fbx24 antibody, F-box protein 24 antibody, FBXO24 antibody, Fbxo24 antibody, fbxo24 antibody
- Background
- FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.
- Molecular Weight
- 36 kDa (MW of target protein)
-