HAL antibody (N-Term)
-
- Target See all HAL Antibodies
- HAL (Histidine Ammonia-Lyase (HAL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HAL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HAL antibody was raised against the N terminal of HAL
- Purification
- Affinity purified
- Immunogen
- HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET
- Top Product
- Discover our top product HAL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAL Blocking Peptide, catalog no. 33R-4075, is also available for use as a blocking control in assays to test for specificity of this HAL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAL (Histidine Ammonia-Lyase (HAL))
- Alternative Name
- HAL (HAL Products)
- Background
- HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.
- Molecular Weight
- 72 kDa (MW of target protein)
-