Myoglobin antibody (N-Term)

Catalog No. ABIN630815

Product Details anti-Myoglobin Antibody

Target: Myoglobin (MB)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myoglobin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Myoglobin antibody was raised against the N terminal of MB

Purification: Affinity purified

Immunogen: Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myoglobin Blocking Peptide, catalog no. 33R-6045, is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS

Concentration: Lot specific

Buffer: PBS, 0.09% sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Myoglobin antibody (ABIN630815)

Bell, Wilding, Funke, Perumal, Beck, Wolters, Holz-Müller, Pfeiffer, Grus: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).

Target Details for Myoglobin

Target: Myoglobin (MB)

Alternative Name: Myoglobin (MB Products)

Synonyms: PVALB antibody, AI325109 antibody, zgc:65819 antibody, zgc:77764 antibody, MB antibody, DKFZp468H096 antibody, myg antibody, mb antibody, MYF4 antibody, bHLHc3 antibody, myo antibody, Myoglobin antibody, myoglobin antibody, myogenin antibody, MB antibody, Mb antibody, mb antibody, myg antibody, Myog antibody

Background: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation