Myoglobin antibody (N-Term)
(1 reference)-
- Target See all Myoglobin (MB) Antibodies
- Myoglobin (MB)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Myoglobin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Myoglobin antibody was raised against the N terminal of MB
- Purification
- Affinity purified
- Immunogen
- Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
- Top Product
- Discover our top product MB Primary Antibody
-
anti-Myoglobin (MB) (AA 1-154) antibody
MB Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reactivity: Sheep WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Myoglobin (MB) (AA 2-100) antibodyMB Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 4F8 unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reactivity: Cow WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Myoglobin (MB) (AA 21-120) antibodyMB Reactivity: Rat, Mouse, Sheep WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Myoglobin (MB) (AA 2-154) antibodyMB Reactivity: Human, Rat, Mouse WB, ELISA, ICC, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Myoglobin (MB) antibodyMB Reactivity: Human IHC, ELISA Host: Mouse Monoclonal 5A2G8 unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reactivity: Human WB, IHC, IP, ICC Host: Mouse Monoclonal C2 unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reactivity: Pig WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Myoglobin Blocking Peptide, catalog no. 33R-6045, is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS, 0.09% sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).
-
: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).
-
- Target
- Myoglobin (MB)
- Alternative Name
- Myoglobin (MB Products)
- Background
- This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.
- Molecular Weight
- 17 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-
