Dnmt2 antibody (N-Term)
-
- Target See all Dnmt2 (TRDMT1) Antibodies
- Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Dnmt2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRDMT1 antibody was raised against the N terminal of TRDMT1
- Purification
- Affinity purified
- Immunogen
- TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV
- Top Product
- Discover our top product TRDMT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRDMT1 Blocking Peptide, catalog no. 33R-6114, is also available for use as a blocking control in assays to test for specificity of this TRDMT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRDMT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))
- Alternative Name
- TRDMT1 (TRDMT1 Products)
- Synonyms
- MGC89267 antibody, DMNT2 antibody, DNMT2 antibody, MHSAIIP antibody, PUMET antibody, RNMT1 antibody, Dnmt2 antibody, Rnmt2 antibody, dnmt2 antibody, tRNA aspartic acid methyltransferase 1 antibody, tRNA aspartic acid methyltransferase 1 L homeolog antibody, trdmt1 antibody, TRDMT1 antibody, Trdmt1 antibody, trdmt1.L antibody
- Background
- CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity.
- Molecular Weight
- 44 kDa (MW of target protein)
-