PRKX antibody (N-Term)

Catalog No. ABIN630810

Product Details anti-PRKX Antibody

Target: PRKX (Protein Kinase, X-Linked (PRKX))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKX antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKX antibody was raised against the N terminal of PRKX

Purification: Affinity purified

Immunogen: PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKX Blocking Peptide, catalog no. 33R-5894, is also available for use as a blocking control in assays to test for specificity of this PRKX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKX

Target: PRKX (Protein Kinase, X-Linked (PRKX))

Alternative Name: PRKX (PRKX Products)

Synonyms: PKX1 antibody, Pkare antibody, protein kinase, X-linked antibody, PRKX antibody, Prkx antibody

Background: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis