PRKX antibody (N-Term)
-
- Target See all PRKX Antibodies
- PRKX (Protein Kinase, X-Linked (PRKX))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKX antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKX antibody was raised against the N terminal of PRKX
- Purification
- Affinity purified
- Immunogen
- PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
- Top Product
- Discover our top product PRKX Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKX Blocking Peptide, catalog no. 33R-5894, is also available for use as a blocking control in assays to test for specificity of this PRKX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKX (Protein Kinase, X-Linked (PRKX))
- Alternative Name
- PRKX (PRKX Products)
- Background
- This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-