GPSM2 antibody

Catalog No. ABIN630807

Product Details anti-GPSM2 Antibody

Target: GPSM2 (G-Protein Signaling Modulator 2 (GPSM2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPSM2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPSM2 Blocking Peptide, catalog no. 33R-10101, is also available for use as a blocking control in assays to test for specificity of this GPSM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPSM2

Target: GPSM2 (G-Protein Signaling Modulator 2 (GPSM2))

Alternative Name: GPSM2 (GPSM2 Products)

Synonyms: CMCS antibody, DFNB82 antibody, LGN antibody, PINS antibody, dfnb82 antibody, lgn antibody, pins antibody, RGD1560967 antibody, Pinsa antibody, zgc:63574 antibody, 6230410J09Rik antibody, Pins antibody, G protein signaling modulator 2 antibody, G-protein signaling modulator 2 S homeolog antibody, G-protein signaling modulator 2 antibody, G-protein signalling modulator 2 (AGS3-like, C. elegans) antibody, GPSM2 antibody, gpsm2.S antibody, Gpsm2 antibody, gpsm2 antibody

Background: Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling