NARG1L antibody (Middle Region)

Catalog No. ABIN630806

Product Details anti-NARG1L Antibody

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NARG1L antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NARG1 L antibody was raised against the middle region of NARG1

Purification: Affinity purified

Immunogen: NARG1 L antibody was raised using the middle region of NARG1 corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NARG1L Blocking Peptide, catalog no. 33R-1516, is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NARG1L

Target: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Alternative Name: NARG1L (NAA16 Products)

Synonyms: NARG1L antibody, 1300019C06Rik antibody, Narg1l antibody, narg1 antibody, narg1l antibody, N(alpha)-acetyltransferase 16, NatA auxiliary subunit antibody, N(alpha)-acetyltransferase 16, NatA auxiliary subunit L homeolog antibody, N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog antibody, NAA16 antibody, Naa16 antibody, naa16.L antibody, naa15.S antibody

Background: NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Molecular Weight: 50 kDa (MW of target protein)